 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Glyma.10G147000.2.p |
| Common Name | GLYMA_10G147000, LOC100786114 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
| Family |
TALE |
| Protein Properties |
Length: 188aa MW: 21693.6 Da PI: 6.679 |
| Description |
TALE family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Glyma.10G147000.2.p | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 31.3 | 3.4e-10 | 130 | 163 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yp++ee+ +L++ +gL+++q+ +WF N+R ++
Glyma.10G147000.2.p 130 WPYPTEEEKVQLSEMTGLDQKQINNWFINQRKRH 163
69*****************************885 PP
|
| 2 | ELK | 37.5 | 5.2e-13 | 83 | 104 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK++LlrKY+gyL+sLk+EF+
Glyma.10G147000.2.p 83 ELKEMLLRKYGGYLSSLKKEFL 104
9********************8 PP
|
| Sequence ? help Back to Top |
| Protein Sequence Length: 188 aa
Download sequence Send
to blast |
MESYCEVLHR YKQELSKPFN EATLFLCSIE SQLSNLCKGT LTMPLDNNHS DEAAGTSEDE 60
LSWEKVEAVE GHESSGPRPG DQELKEMLLR KYGGYLSSLK KEFLKKRKKG KLPKDARMVL 120
MDWWNTHYRW PYPTEEEKVQ LSEMTGLDQK QINNWFINQR KRHWKPSEDM RFAIMDGVSG 180
SGFGGPI*
|
| Nucleic Localization
Signal ? help
Back to Top |
 |
| No. |
Start |
End |
Sequence |
| 1 | 98 | 107 | LKKEFLKKRK |
| 2 | 104 | 108 | KKRKK |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693}. |
| Uniprot | DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium, and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:10488233}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. |
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. |
| Publications
? help Back to Top |
- Ito Y,Eiguchi M,Kurata N
KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice.
Genesis, 2001. 30(4): p. 231-8
[PMID:11536429] - Postma-Haarsma AD, et al.
Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice.
Plant Mol. Biol., 2002. 48(4): p. 423-41
[PMID:11908517] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Kuijt SJ, et al.
Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice.
Plant Mol. Biol., 2004. 55(6): p. 781-96
[PMID:15604716] - Cheng CH, et al.
A fine physical map of the rice chromosome 5.
Mol. Genet. Genomics, 2005. 274(4): p. 337-45
[PMID:16261349] - Chu H, et al.
A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
J. Exp. Bot., 2013. 64(17): p. 5359-69
[PMID:24043854] - Kuijt SJ, et al.
Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
Plant Physiol., 2014. 164(4): p. 1952-66
[PMID:24532604] - Coudert Y, et al.
Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
New Phytol., 2015. 206(1): p. 243-54
[PMID:25442012] - Xu Y, et al.
OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice.
Plant J., 2015. 83(5): p. 806-17
[PMID:26121094] - Kir G, et al.
RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture.
Plant Physiol., 2015. 169(1): p. 826-39
[PMID:26162429]
|
