PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.10G020100.1.p | ||||||||
Common Name | GLYMA_10G020100, LOC100796514 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 146aa MW: 16249.2 Da PI: 5.9865 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 170.4 | 2.1e-53 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 +eqdr+lPianv+rimk++lP nakisk+aket+qe vsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy eplk yl kyr Glyma.10G020100.1.p 33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQESVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYSEPLKRYLYKYR 122 89**************************************************************************************** PP NF-YB 92 elegek 97 e+ege+ Glyma.10G020100.1.p 123 EMEGER 128 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.1E-51 | 29 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.45E-40 | 35 | 140 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.1E-27 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.2E-19 | 66 | 84 | No hit | No description |
PRINTS | PR00615 | 3.2E-19 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 3.2E-19 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MGDNIGKVLD REGFKYNFTA SASGTSAQDG VIKEQDRLLP IANVGRIMKQ ILPPNAKISK 60 EAKETMQESV SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALATLGFDDY SEPLKRYLYK 120 YREMEGERAN QNKGSNGYEN NIANI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-43 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-43 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.403 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.10G020100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 1e-115 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003536891.1 | 1e-105 | nuclear transcription factor Y subunit B-5 | ||||
Refseq | XP_028183993.1 | 1e-105 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 6e-59 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | I1L7X0 | 1e-104 | I1L7X0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G02480.1 | 1e-105 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-61 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.10G020100.1.p |
Entrez Gene | 100796514 |
Publications ? help Back to Top | |||
---|---|---|---|
|