PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

ZF-HD

Protein Properties

Length: 74aa MW: 8108.25 Da PI: 8.3397

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.09G238700.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	74.5	1.6e-23	8	62	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 ++ ++eC++N A ++Gg+ +DGC+ f++s g+egtaaa++Ca CgCH+nFHRre+ Glyma.09G238700.1.p 8 NTIHRECRRNYACRVGGYILDGCRQFVAS-GAEGTAAAMTCATCGCHKNFHRREEL 62 5679**********************9.999******************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	8.7E-26	9	61	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	21.18	11	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	6.4E-19	12	60	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	2.0E-6	13	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MPRRCPHNTI HRECRRNYAC RVGGYILDGC RQFVASGAEG TAAAMTCATC GCHKNFHRRE 60 ELPHVVCGCN NEA*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.09G238700.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027359393.1	6e-22	LOW QUALITY PROTEIN: mini zinc finger protein 2-like
Swissprot	Q9LJW5	4e-20	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A445J5D0	3e-46	A0A445J5D0_GLYSO; Mini zinc finger protein 2
TrEMBL	K7LFR2	3e-46	K7LFR2_SOYBN; Uncharacterized protein
STRING	GLYMA09G37331.1	5e-47	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF35812	2	2
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	8e-11	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Glyma.09G238700.1.p

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]