 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Glyma.09G092900.1.p |
| Common Name | GLYMA_09G092900 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
| Family |
MYB |
| Protein Properties |
Length: 119aa MW: 13600 Da PI: 10.6012 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Glyma.09G092900.1.p | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 31.5 | 4.2e-10 | 31 | 70 | 9 | 48 |
HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+ +lv +++++G+g+W++++++ g+ R+ k+c++r +yl
Glyma.09G092900.1.p 31 HIILVSYIQEHGPGNWRAVPAKTGLSRCIKSCRLRSTNYL 70
889********************************88886 PP
|
| 2 | Myb_DNA-binding | 25.6 | 2.8e-08 | 77 | 108 | 2 | 35 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgR 35
g++T++E++ ++++ +lG++ W++Ia++++ R
Glyma.09G092900.1.p 77 GNFTEQEEKMIIHLQDLLGNR-WAAIASYLP-QR 108
79*******************.*********.44 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: Expressed in 2-week-old seedlings, in the early stages of development. {ECO:0000269|PubMed:10571865}. |
| Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, leaves and weakly in seed pods. {ECO:0000269|PubMed:1840903}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in germinating seeds, rosette and cauline leaves, flower buds, open flowers, stems and developing siliques. {ECO:0000269|PubMed:25305760}. |
| Uniprot | TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, hypocotyl and roots. {ECO:0000269|PubMed:24587042}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}. |
| UniProt | Transcription factor. {ECO:0000305}. |
| UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}. |
| UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | BT093784 | 1e-116 | BT093784.1 Soybean clone JCVI-FLGm-24M4 unknown mRNA. |
| GenBank | FJ768022 | 1e-116 | FJ768022.1 Glycine max transcription factor MYB392 mRNA, complete cds. |
| GenBank | KT031204 | 1e-116 | KT031204.1 Glycine max clone HN_CCL_69 MYB/HD-like transcription factor (Glyma18g49360.1) mRNA, partial cds. |
| Orthologous Group
? help Back to Top |
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP5 | 17 | 1784 |
| Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
Expression patterns of myb genes from Antirrhinum flowers.
Plant Cell, 1991. 3(2): p. 115-25
[PMID:1840903] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Kaurilind E,Xu E,Brosché M
A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
BMC Genomics, 2015. 16: p. 837
[PMID:26493993] - Cui F, et al.
Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation.
Mol Plant, 2016. 9(6): p. 926-38
[PMID:27060495] - Lee SB,Kim HU,Suh MC
MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.
Plant Cell Physiol., 2016. 57(11): p. 2300-2311
[PMID:27577115] - Lee HG,Seo PJ
The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
Nat Commun, 2016. 7: p. 12525
[PMID:27615387] - Serrano I, et al.
A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana.
Elife, 2017.
[PMID:27685353] - Liao C,Zheng Y,Guo Y
MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis.
New Phytol., 2017. 216(1): p. 163-177
[PMID:28726305] - Lee HG,Kim J,Suh MC,Seo PJ
The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
Plant Cell Physiol., 2017. 58(7): p. 1249-1259
[PMID:28838126] - Mabuchi K, et al.
MYB30 links ROS signaling, root cell elongation, and plant immune responses.
Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719
[PMID:29712840] - Zheng Y,Chen Z,Ma L,Liao C
The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling.
Plant Physiol., 2018. 178(1): p. 428-440
[PMID:30030326]
|
