![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.08G141000.2.p | ||||||||
Common Name | GLYMA_08G141000, LOC100797721 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 194aa MW: 21366.9 Da PI: 6.6795 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 146.2 | 7.2e-46 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl++yre+egek Glyma.08G141000.2.p 1 MKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKLYLNNYRETEGEK 81 9******************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 4.35E-32 | 1 | 89 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.4E-20 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 6.5E-43 | 1 | 91 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.4E-18 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-18 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.4E-18 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MKRALPANAK ISKEAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF 60 ENYVGPLKLY LNNYRETEGE KSSTSMAKQE ELHSPTHQHQ TNIDGVVEIN KLLPHSVAAA 120 TKASDFNNTT FSAGGFYSVG PHQVTAPKSF TEMGGLNGYR ESSIAQSALS ADQIQDASGN 180 RMMPPNLRYR VEW* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-37 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-37 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.08G141000.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 1e-111 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003532849.1 | 1e-145 | nuclear transcription factor Y subunit B-10 isoform X1 | ||||
Refseq | XP_014634440.1 | 1e-145 | nuclear transcription factor Y subunit B-8 isoform X2 | ||||
Refseq | XP_028243842.1 | 1e-145 | nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Refseq | XP_028243843.1 | 1e-145 | nuclear transcription factor Y subunit B-8-like isoform X2 | ||||
TrEMBL | A0A445JEJ6 | 1e-144 | A0A445JEJ6_GLYSO; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | K7L6M6 | 1e-144 | K7L6M6_SOYBN; Uncharacterized protein | ||||
TrEMBL | K7L6M7 | 1e-144 | K7L6M7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA08G14931.1 | 1e-145 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-52 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.08G141000.2.p |
Entrez Gene | 100797721 |