![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.07G199000.3.p | ||||||||
Common Name | GLYMA_07G199000, LOC100789055 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 114aa MW: 12936.2 Da PI: 6.6636 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 76.6 | 3.8e-24 | 65 | 110 | 2 | 47 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47 Cqv++C+adlseak+yhrrhkvCe h+kap+v ++gl+qrfCqqCs Glyma.07G199000.3.p 65 CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCS 110 *********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.5E-26 | 57 | 110 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.785 | 62 | 113 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.84E-23 | 63 | 111 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.5E-19 | 65 | 110 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MDTSRYEGKR VLRYKEEDEN DDDEEEEEVS EVGFGADRRR NKRVMRDLHG KRSGSKGGGS 60 MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKAPSVHMAG LQQRFCQQCS SPS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-20 | 54 | 110 | 1 | 56 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.07G199000.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096726 | 0.0 | BT096726.1 Soybean clone JCVI-FLGm-15P19 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001239985.1 | 3e-79 | uncharacterized protein LOC100789055 | ||||
TrEMBL | C6TGH6 | 7e-78 | C6TGH6_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA07G31880.1 | 6e-76 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 8e-22 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.07G199000.3.p |
Entrez Gene | 100789055 |