PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

HSF

Protein Properties

Length: 91aa MW: 10473.9 Da PI: 9.0735

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.07G086300.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	79.5	5.2e-25	15	78	2	65
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65 F+ k+y++++d+++++li+w +nsf+vld+ +f++++Lp++Fkh+nf+SFvRQLn+Y ++ Glyma.07G086300.1.p 15 FVIKTYNMVNDPTTDKLITWGPANNSFIVLDPLDFSHSLLPTFFKHNNFSSFVRQLNTYKTRNK 78 9******************999*********************************86655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.0E-26	9	83	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	5.1E-20	11	89	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	3.54E-23	12	86	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	2.3E-15	15	38	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	8.5E-21	15	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.3E-15	53	65	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.3E-15	66	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MEHNIIVNNN VIAPFVIKTY NMVNDPTTDK LITWGPANNS FIVLDPLDFS HSLLPTFFKH 60 NNFSSFVRQL NTYKTRNKHT FDNTLFSSHM *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	4e-18	12	77	17	82	Heat shock factor protein 1
5d5u_B	5e-18	12	77	26	91	Heat shock factor protein 1
5d5v_B	5e-18	12	77	26	91	Heat shock factor protein 1
5d5v_D	5e-18	12	77	26	91	Heat shock factor protein 1
5hdg_A	3e-18	12	77	7	72	Heat shock factor protein 1
5hdn_A	3e-18	12	77	7	72	Heat shock factor protein 1
5hdn_B	3e-18	12	77	7	72	Heat shock factor protein 1
5hdn_C	3e-18	12	77	7	72	Heat shock factor protein 1
5hdn_D	3e-18	12	77	7	72	Heat shock factor protein 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.29358	4e-98	cotyledon\| hypocotyl\| leaf

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.07G086300.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015044	3e-83	AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028239788.1	2e-46	heat stress transcription factor C-1-like
Swissprot	Q9LV52	8e-33	HSFC1_ARATH; Heat stress transcription factor C-1
TrEMBL	A0A368UHX6	6e-58	A0A368UHX6_SOYBN; Uncharacterized protein
STRING	GLYMA07G09510.1	1e-58	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95
Representative plant	OGRP96	17	233

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24520.1	3e-35	heat shock transcription factor C1

Link Out ? help Back to Top
Phytozome	Glyma.07G086300.1.p

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guan Q,Yue X,Zeng H,Zhu J The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis. Plant Cell, 2014. 26(1): p. 438-53 [PMID:24415771]