PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G086300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HSF
Protein Properties Length: 91aa    MW: 10473.9 Da    PI: 9.0735
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G086300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind79.55.2e-251578265
                         HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE- CS
         HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkv 65
                         F+ k+y++++d+++++li+w   +nsf+vld+ +f++++Lp++Fkh+nf+SFvRQLn+Y  ++ 
  Glyma.07G086300.1.p 15 FVIKTYNMVNDPTTDKLITWGPANNSFIVLDPLDFSHSLLPTFFKHNNFSSFVRQLNTYKTRNK 78
                         9********************999***********************************86655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.0E-26983IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.1E-201189IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.54E-231286IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.3E-151538IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004478.5E-211578IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.3E-155365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.3E-156678IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MEHNIIVNNN VIAPFVIKTY NMVNDPTTDK LITWGPANNS FIVLDPLDFS HSLLPTFFKH  60
NNFSSFVRQL NTYKTRNKHT FDNTLFSSHM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A4e-1812771782Heat shock factor protein 1
5d5u_B5e-1812772691Heat shock factor protein 1
5d5v_B5e-1812772691Heat shock factor protein 1
5d5v_D5e-1812772691Heat shock factor protein 1
5hdg_A3e-181277772Heat shock factor protein 1
5hdn_A3e-181277772Heat shock factor protein 1
5hdn_B3e-181277772Heat shock factor protein 1
5hdn_C3e-181277772Heat shock factor protein 1
5hdn_D3e-181277772Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.293584e-98cotyledon| hypocotyl| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.07G086300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150443e-83AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028239788.12e-46heat stress transcription factor C-1-like
SwissprotQ9LV528e-33HSFC1_ARATH; Heat stress transcription factor C-1
TrEMBLA0A368UHX66e-58A0A368UHX6_SOYBN; Uncharacterized protein
STRINGGLYMA07G09510.11e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.13e-35heat shock transcription factor C1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Guan Q,Yue X,Zeng H,Zhu J
    The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 438-53
    [PMID:24415771]