![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.06G324400.3.p | ||||||||
Common Name | GLYMA_06G324400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 193aa MW: 22498.7 Da PI: 10.0875 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.4 | 6.7e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Glyma.06G324400.3.p 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 95.4 | 8.8e-32 | 76 | 157 | 3 | 84 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 +ss + ++e +a+++qqe+akL+++i++Lq+++Rhl+G+ L++L++keL+qLe++Le+++++iRskK+e+ll++ie+ qk+ Glyma.06G324400.3.p 76 HSSASTTTEINAQYYQQESAKLRQQIQMLQNSNRHLMGDALSTLTVKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKRV 157 4566668999**********************************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 34.118 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.62E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.60E-44 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 3.6E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.6E-23 | 84 | 156 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.136 | 87 | 185 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 NIRSTIERYK KACSDHSSAS TTTEINAQYY QQESAKLRQQ IQMLQNSNRH LMGDALSTLT 120 VKELKQLENR LERGITRIRS KKHEMLLAEI EYFQKRVIHE LISSSTSNYH YFSFFLFLWR 180 EREGVLLYPS GG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-22 | 1 | 82 | 1 | 82 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.6760 | 0.0 | flower| pod| seed coat |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.06G324400.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | DQ371899 | 0.0 | DQ371899.1 Glycine max MADS domain transporter AGL11 (AGL11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001236130.1 | 1e-109 | MADS domain transporter AGL11 | ||||
Refseq | XP_006580912.1 | 1e-109 | MADS domain transporter AGL11 isoform X1 | ||||
Refseq | XP_006580913.1 | 1e-109 | MADS domain transporter AGL11 isoform X2 | ||||
Refseq | XP_014631604.1 | 1e-109 | MADS domain transporter AGL11 isoform X1 | ||||
Refseq | XP_028238522.1 | 1e-109 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_028238523.1 | 1e-109 | agamous-like MADS-box protein AGL11 | ||||
Refseq | XP_028238524.1 | 1e-109 | agamous-like MADS-box protein AGL11 | ||||
Swissprot | F6I457 | 1e-100 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A0R0JP08 | 1e-138 | A0A0R0JP08_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445KHS3 | 1e-138 | A0A445KHS3_GLYSO; Agamous-like MADS-box protein AGL11 isoform B | ||||
STRING | GLYMA06G48270.2 | 1e-109 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.4 | 3e-96 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.06G324400.3.p |