 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Glyma.06G010200.1.p |
| Common Name | bZIP123, GLYMA_06G010200, Glyma06g01240.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
| Family |
bZIP |
| Protein Properties |
Length: 139aa MW: 15728.8 Da PI: 10.1594 |
| Description |
bZIP family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Glyma.06G010200.1.p | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 39.6 | 1.1e-12 | 24 | 82 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r+++NRe+ArrsR RK++ ++ L+ +L ++N++L ++ + ++ ++++e+
Glyma.06G010200.1.p 24 RKRKRMISNRESARRSRMRKQKHLDDLASQLTQLRSQNQQLLTSVNLTSHKYLAVEAEN 82
6789**************************************99998888887777665 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Sequence ? help Back to Top |
| Protein Sequence Length: 139 aa
Download sequence Send
to blast |
MTMACSSGTS SGTSSELQGM MDQRKRKRMI SNRESARRSR MRKQKHLDDL ASQLTQLRSQ 60
NQQLLTSVNL TSHKYLAVEA ENSVLRAQVN ELSHRLDSLN QIIHLLNFFE PDASTSTFFN 120
NPFNFSLPIM ASADMLQY*
|
| Nucleic Localization
Signal ? help
Back to Top |
 |
| No. |
Start |
End |
Sequence |
| 1 | 23 | 44 | RKRKRMISNRESARRSRMRKQK |
| 2 | 36 | 43 | RRSRMRKQ |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
| Function -- GeneRIF ? help
Back to Top |
- GmbZIP123 may participate in regulation of lipid accumulation in soybean seeds.
[PMID: 23963672]
|
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | KT031136 | 0.0 | KT031136.1 Glycine max clone HN_CCL_125 BZIP transcription factor (Glyma06g01240.1) mRNA, partial cds. |
| Publications
? help Back to Top |
- Liao Y, et al.
Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis.
Planta, 2008. 228(2): p. 225-40
[PMID:18365246] - Song QX, et al.
Soybean GmbZIP123 gene enhances lipid content in the seeds of transgenic Arabidopsis plants.
J. Exp. Bot., 2013. 64(14): p. 4329-41
[PMID:23963672] - Mair A, et al.
SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.
Elife, 2016.
[PMID:26263501] - Chai C, et al.
Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
BMC Genomics, 2015. 16: p. 596
[PMID:26268547] - Sagor GH, et al.
A novel strategy to produce sweeter tomato fruits with high sugar contents by fruit-specific expression of a single bZIP transcription factor gene.
Plant Biotechnol. J., 2016. 14(4): p. 1116-26
[PMID:26402509] - Walper E,Weiste C,Mueller MJ,Hamberg M,Dröge-Laser W
Screen Identifying Arabidopsis Transcription Factors Involved in the Response to 9-Lipoxygenase-Derived Oxylipins.
PLoS ONE, 2016. 11(4): p. e0153216
[PMID:27073862] - Wang XY, et al.
Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.
Plant Physiol. Biochem., 2016. 107: p. 273-287
[PMID:27337039] - Weiste C, et al.
The Arabidopsis bZIP11 transcription factor links low-energy signalling to auxin-mediated control of primary root growth.
PLoS Genet., 2017. 13(2): p. e1006607
[PMID:28158182] - Yamashita Y, et al.
Sucrose sensing through nascent peptide-meditated ribosome stalling at the stop codon of Arabidopsis bZIP11 uORF2.
FEBS Lett., 2017. 591(9): p. 1266-1277
[PMID:28369795] - Ezer D, et al.
The G-Box Transcriptional Regulatory Code in Arabidopsis.
Plant Physiol., 2017. 175(2): p. 628-640
[PMID:28864470] - Lee DH,Park SJ,Ahn CS,Pai HS
MRF Family Genes Are Involved in Translation Control, Especially under Energy-Deficient Conditions, and Their Expression and Functions Are Modulated by the TOR Signaling Pathway.
Plant Cell, 2017. 29(11): p. 2895-2920
[PMID:29084871] - Pedrotti L, et al.
Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
Plant Cell, 2018. 30(2): p. 495-509
[PMID:29348240]
|
