PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

bZIP

Protein Properties

Length: 164aa MW: 18364.6 Da PI: 4.9668

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.05G157000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	43.7	5.8e-14	32	90	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR RK++ +e L ++L++eN + +++ ++++ ++++e+ Glyma.05G157000.1.p 32 RKRKRMLSNRESARRSRIRKQQHLEGLSAQLDQLKKENAQINTNISITTQMYLNVEAEN 90 7889******************************************9999999988876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.1E-15	28	92	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.0E-10	29	76	No hit	No description
PROSITE profile	PS50217	10.346	30	77	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	7.9E-10	31	83	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.31E-11	32	85	No hit	No description
CDD	cd14702	1.46E-17	33	83	No hit	No description
PROSITE pattern	PS00036	0	35	50	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MASPGGSGTY SSGSSSLQNS GSEGDRDIME QRKRKRMLSN RESARRSRIR KQQHLEGLSA 60 QLDQLKKENA QINTNISITT QMYLNVEAEN AILRAQMGEL SNRLNSLNEM ISFINSTNNN 120 CLMMFDEAQE TTTQLFNDCG FMDYAWNGIP IMASADNEML IMY*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	44	51	RRSRIRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.64230	0.0	cotyledon\| hypocotyl\| root\| seed coat\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269\|PubMed:23461773}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.05G157000.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT031135	0.0	KT031135.1 Glycine max clone HN_CCL_129 BZIP transcription factor (Glyma05g28960.1) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001237162.1	1e-117	bZIP transcription factor bZIP111
Swissprot	C0Z2L5	1e-40	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	Q0GPG2	1e-116	Q0GPG2_SOYBN; BZIP transcription factor
STRING	GLYMA05G28960.1	1e-117	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147
Representative plant	OGRP551	16	78

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75390.1	2e-39	basic leucine-zipper 44

Link Out ? help Back to Top
Phytozome	Glyma.05G157000.1.p
Entrez Gene	778140

Publications ? help Back to Top
Liao Y, et al. Soybean GmbZIP44, GmbZIP62 and GmbZIP78 genes function as negative regulator of ABA signaling and confer salt and freezing tolerance in transgenic Arabidopsis. Planta, 2008. 228(2): p. 225-40 [PMID:18365246] Chai C, et al. Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance. BMC Genomics, 2015. 16: p. 596 [PMID:26268547] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]