 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Glyma.04G175800.1.p |
Common Name | GLYMA_04G175800 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
Family |
NAC |
Protein Properties |
Length: 78aa MW: 9020.34 Da PI: 9.4529 |
Description |
NAC family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Glyma.04G175800.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 77 | 4.5e-24 | 2 | 78 | 13 | 93 |
NAM 13 elvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
elv +yLk+kv + +l++ ++i+e++++k++PwdLp e+e yfFs++ ky++g+r+nrat+sgyWkatg dk+++
Glyma.04G175800.1.p 2 ELVLQYLKRKVFSYPLPA-SIIPELHVCKSDPWDLPGD---LEQERYFFSTKVAKYPNGNRSNRATNSGYWKATGLDKQIV 78
9*****************.89***************54...46799********************************985 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 5e-19 | 2 | 77 | 29 | 107 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-19 | 2 | 77 | 29 | 107 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-19 | 2 | 77 | 29 | 107 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-19 | 2 | 77 | 29 | 107 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swm_B | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swm_C | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swm_D | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swp_A | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swp_B | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swp_C | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
3swp_D | 5e-19 | 2 | 77 | 32 | 110 | NAC domain-containing protein 19 |
4dul_A | 5e-19 | 2 | 77 | 29 | 107 | NAC domain-containing protein 19 |
4dul_B | 5e-19 | 2 | 77 | 29 | 107 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene
? help Back to Top |
UniGene ID |
E-value |
Expressed in |
Gma.26892 | 1e-124 | cotyledon| hypocotyl| leaf| root| seed coat |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. |
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | EU661915 | 1e-122 | EU661915.1 Glycine max NAC domain protein (NAC15) mRNA, complete cds. |