PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

ZF-HD

Protein Properties

Length: 90aa MW: 9582.8 Da PI: 8.855

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.04G169900.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.9	4.3e-32	20	77	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++rY eC+kNhAa++Gg+avDGC+Efm+s + eg al+CaACgCHRnFHRrev++e Glyma.04G169900.1.p 20 RNIRYGECQKNHAANIGGYAVDGCREFMAS-TGEGAGGALTCAACGCHRNFHRREVNTE 77 579************************9.667899****************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-22	1	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.9E-29	22	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	5.8E-26	23	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.257	24	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048509	Biological Process	regulation of meristem development

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MKKRQVVVKS VANTSSSVMR NIRYGECQKN HAANIGGYAV DGCREFMAST GEGAGGALTC 60 AACGCHRNFH RREVNTEVVC EYSPPNSGR*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.566	1e-152	epicotyl\| hypocotyl

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:18713354}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.04G169900.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	9e-93	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003522326.1	3e-60	mini zinc finger protein 3
Refseq	XP_014632621.1	3e-60	mini zinc finger protein 3
Refseq	XP_028229098.1	3e-60	mini zinc finger protein 3-like
Refseq	XP_028237252.1	3e-60	mini zinc finger protein 3-like
Swissprot	Q2Q493	7e-40	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	A0A0B2RJL3	6e-59	A0A0B2RJL3_GLYSO; Mini zinc finger protein 3
TrEMBL	I1JWV2	6e-59	I1JWV2_SOYBN; Uncharacterized protein
STRING	GLYMA04G33640.1	1e-59	(Glycine max)
STRING	GLYMA06G20810.1	1e-59	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	1e-33	mini zinc finger

Link Out ? help Back to Top
Phytozome	Glyma.04G169900.1.p
Entrez Gene	100785967 \| 100794835