PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.03G177700.3.p | ||||||||
Common Name | GLYMA_03G177700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 101aa MW: 12127.2 Da PI: 8.7193 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 81.1 | 1.4e-25 | 43 | 89 | 48 | 94 |
NF-YB 48 seasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 + asdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+e Glyma.03G177700.3.p 43 CRASDKCQREKRKTINGDDLLWAMATLGFEDYMDPLKIYLTRYREME 89 579******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 6.3E-5 | 44 | 66 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 7.1E-20 | 44 | 89 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.28E-16 | 44 | 89 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 2.8E-10 | 49 | 67 | No hit | No description |
PRINTS | PR00615 | 2.8E-10 | 68 | 86 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MRLRVHQLHH QRVSVFFFSS DSFLLRFSYL SSPAFNLKFL EFCRASDKCQ REKRKTINGD 60 DLLWAMATLG FEDYMDPLKI YLTRYREMEV IFNIFILMIE * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-17 | 45 | 87 | 50 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-17 | 45 | 87 | 50 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.59809 | 2e-72 | flower| leaf| pod| somatic embryo |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.03G177700.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003521372.1 | 4e-27 | nuclear transcription factor Y subunit B-10 | ||||
Refseq | XP_028225788.1 | 4e-27 | nuclear transcription factor Y subunit B-10-like | ||||
Swissprot | Q67XJ2 | 4e-26 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | A0A0R0KL05 | 7e-68 | A0A0R0KL05_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G33490.1 | 2e-26 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 3e-28 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.03G177700.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|