PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB

Protein Properties

Length: 261aa MW: 30053.6 Da PI: 6.5105

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.02G009800.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.6	1.4e-18	19	66	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd l+++v+ +G g+W++ ar g++Rt+k+c++rw++yl Glyma.02G009800.1.p 19 KGPWTEEEDSVLINYVNVHGEGHWNSLARSSGLKRTGKSCRLRWFNYL 66 79********************************************97 PP
2	Myb_DNA-binding	45.9	1.3e-14	72	115	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T +E++l+++++ +G++ W++Ia+ ++ gRt++++k++w++ Glyma.02G009800.1.p 72 RGNITLQEQLLILELHSHWGNR-WAKIAEQLP-GRTDNEIKNYWRT 115 7899****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.472	14	70	IPR017930	Myb domain
SuperFamily	SSF46689	1.94E-30	17	113	IPR009057	Homeodomain-like
SMART	SM00717	5.2E-15	18	68	IPR001005	SANT/Myb domain
Pfam	PF00249	8.4E-16	19	66	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.2E-22	20	73	IPR009057	Homeodomain-like
CDD	cd00167	5.00E-11	21	66	No hit	No description
PROSITE profile	PS51294	18.585	71	121	IPR017930	Myb domain
SMART	SM00717	4.7E-13	71	119	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-13	72	115	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.0E-21	74	119	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 261 aa Download sequence Send to blast
METMNVQVMR SLSDMVIKKG PWTEEEDSVL INYVNVHGEG HWNSLARSSG LKRTGKSCRL 60 RWFNYLRPNV RRGNITLQEQ LLILELHSHW GNRWAKIAEQ LPGRTDNEIK NYWRTRVVKQ 120 AKQLKCHVNS KQFRDALRFV WMPRLMEQIQ ASSSSYGLDQ TTLCNTQTHR DNSMVSSYSS 180 EVDLQPPSLS DTSITSSSYN LIGDGGLSTE SAEKGSIYSL WQHWDYSDIQ AFEPCNGFGD 240 ADLWTDENMW FLQQHLADEL *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-25	11	121	1	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gma.28259	0.0	leaf\| root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269\|PubMed:22301384}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.02G009800.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC589299	0.0	KC589299.1 Macrotyloma uniflorum cultivar VZM-1 transcription factor MYB76 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001235761.1	0.0	MYB transcription factor MYB76
Refseq	XP_028192544.1	0.0	transcription factor MYB78-like
Swissprot	Q10MB4	6e-75	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A445LHZ9	0.0	A0A445LHZ9_GLYSO; Transcription factor MYB2
TrEMBL	Q0PJK7	0.0	Q0PJK7_SOYBN; MYB transcription factor MYB76
STRING	GLYMA02G01300.1	0.0	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF875	34	125
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47190.1	4e-67	myb domain protein 2

Link Out ? help Back to Top
Phytozome	Glyma.02G009800.1.p
Entrez Gene	778040

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]