PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja

Family

MYB_related

Protein Properties

Length: 109aa MW: 12716.5 Da PI: 10.683

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Glyma.01G101400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.1	2.7e-15	54	98	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g T++E+ ++++++ ++G++ W+tIar ++ gR ++++k++w+++ Glyma.01G101400.1.p 54 KGQITPQEESIILQLHVRWGNR-WSTIARSLP-GRIDNEIKNYWRTH 98 5778****************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.59E-15	45	104	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.2E-23	45	103	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.647	49	103	IPR017930	Myb domain
SMART	SM00717	1.4E-12	53	101	IPR001005	SANT/Myb domain
Pfam	PF00249	4.6E-13	54	98	IPR001005	SANT/Myb domain
CDD	cd00167	1.94E-8	58	99	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MAGNMGWGVI EEEGWRKGPS TSEEDILYVK FHGEGRWNSA ARLAVNYLRP DLKKGQITPQ 60 EESIILQLHV RWGNRWSTIA RSLPGRIDNE IKNYWRTHFK KKIRAHFR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-17	17	103	27	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269\|PubMed:16531467}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Glyma.01G101400.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (SA). {ECO:0000269\|PubMed:16463103}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT097047	6e-76	BT097047.1 Soybean clone JCVI-FLGm-15J22 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_014632633.1	7e-65	myb-related protein 305
Swissprot	Q9LX82	2e-33	MYB48_ARATH; Transcription factor MYB48
TrEMBL	K7K2Z5	5e-74	K7K2Z5_SOYBN; Uncharacterized protein
STRING	GLYMA01G24771.1	8e-75	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1182	34	108
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24310.1	2e-49	myb domain protein 305

Link Out ? help Back to Top
Phytozome	Glyma.01G101400.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Imran QM, et al. Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes. Sci Rep, 2018. 8(1): p. 771 [PMID:29335449]