PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca237915G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GRAS
Protein Properties Length: 53aa    MW: 6117.04 Da    PI: 6.4275
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca237915G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS47.72.8e-15153321374
             GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +aGF+p+pls+ +++++k+ll+++ ++ yr+ee++g+l+lgW++r Lv+ +aW+
  Gh_Sca237915G01   1 MAGFTPYPLSSLVNATIKTLLENYCDR-YRLEERDGALYLGWMNRDLVASCAWK 53 
                      69***********************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035149.6E-13153IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MAGFTPYPLS SLVNATIKTL LENYCDRYRL EERDGALYLG WMNRDLVASC AWK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.165782e-80boll| ovule
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021633759.12e-32scarecrow-like protein 21
SwissprotQ9LDL75e-27PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A2C9UPE93e-31A0A2C9UPE9_MANES; Uncharacterized protein
TrEMBLA0A2C9UQQ05e-31A0A2C9UQQ0_MANES; Uncharacterized protein
STRINGcassava4.1_004951m8e-32(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.22e-29GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]