 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Gh_Sca106972G01 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
Family |
LBD |
Protein Properties |
Length: 96aa MW: 10681.3 Da PI: 8.2215 |
Description |
LBD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Gh_Sca106972G01 | genome | NAU-NBI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | DUF260 | 131.5 | 3.4e-41 | 11 | 96 | 1 | 86 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86
+CaaCk+lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kl++++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q
Gh_Sca106972G01 11 PCAACKFLRRKCMPDCVFAPYFPPEEPHKFINVHKIFGASNVSKLINEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQ 96
7********************************************************************************99987 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |