 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Gh_Sca088565G01 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
| Family |
MYB_related |
| Protein Properties |
Length: 85aa MW: 9544.75 Da PI: 4.106 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Gh_Sca088565G01 | genome | NAU-NBI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 42.3 | 1.8e-13 | 38 | 80 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g+WT +E +ll++a +++ + W+ Ia+++ ++t qc++++++
Gh_Sca088565G01 38 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFLQ 80
89*****************88.*********.**********986 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 2yus_A | 2e-11 | 18 | 85 | 1 | 66 | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 |
| Search in ModeBase |
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:14682613}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. |
| Publications
? help Back to Top |
- Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A
AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time.
Nucleic Acids Res., 2002. 30(15): p. 3412-21
[PMID:12140326] - Zhou C,Miki B,Wu K
CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis.
Plant Mol. Biol., 2003. 52(6): p. 1125-34
[PMID:14682613] - Sarnowski TJ, et al.
SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development.
Plant Cell, 2005. 17(9): p. 2454-72
[PMID:16055636] - Liu ZW, et al.
The SET domain proteins SUVH2 and SUVH9 are required for Pol V occupancy at RNA-directed DNA methylation loci.
PLoS Genet., 2014. 10(1): p. e1003948
[PMID:24465213] - Liu ZW, et al.
Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.
PLoS Genet., 2016. 12(5): p. e1006026
[PMID:27171427]
|
