![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D13G1913 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 163aa MW: 18684.7 Da PI: 10.6498 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 41.7 | 1.5e-13 | 11 | 51 | 3 | 43 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 i n+s r++t+ kR +g+lKK E+ +LC++++ +i s++ Gh_D13G1913 11 ITNDSARKTTYKKRSKGLLKKVREITTLCGIQAFAVINSPD 51 89*******************************99999876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 15.502 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.5E-17 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.45E-20 | 3 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-7 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 2.38E-21 | 3 | 86 | No hit | No description |
Pfam | PF00319 | 3.6E-13 | 11 | 51 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-7 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MSRKKIKLAY ITNDSARKTT YKKRSKGLLK KVREITTLCG IQAFAVINSP DFGSQAEVWP 60 SLEDARRLLS EFKKLPLTKQ NKNMVNQESF LEQSLAKATQ QLRKLREENR QKELKEVMFE 120 SLSGKGILQS LNAMDLDEVD LLIKQNLADI DNRVRVLTKA SRS |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.12596 | 0.0 | boll |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC243101 | 8e-73 | AC243101.1 Gossypium arboreum clone GM203N05-jhe, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016670153.1 | 1e-115 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 3e-44 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A1U8I1R8 | 1e-113 | A0A1U8I1R8_GOSHI; agamous-like MADS-box protein AGL80 | ||||
STRING | Gorai.013G210300.1 | 1e-111 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 1e-46 | AGAMOUS-like 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|