PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D11G0405

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 157aa MW: 18100.9 Da PI: 9.9152

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D11G0405	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	148.7	3e-46	12	135	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrF+Pt+eelv +yLk k+ + +l++ ++i++++i++++PwdLp ++ +e yfFs ++ ky+tg+r nrat+sgyWkatg+dk+++s++++ Gh_D11G0405 12 LPPGFRFQPTEEELVFQYLKCKAFSFPLPA-SIIPDLNICNFDPWDLPGEL---GEERYFFSMKEAKYKTGNRINRATASGYWKATGSDKQIISRRNQ 105 79**************************.89***********553...5799************************************ PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 + g++ktLvf+ g+ p+g +tdW+++eyrl Gh_D11G0405 106 VAGMRKTLVFHMGKPPHGLRTDWIINEYRL 135 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.36E-50	8	142	IPR003441	NAC domain
PROSITE profile	PS51005	47.252	12	157	IPR003441	NAC domain
Pfam	PF02365	1.3E-22	13	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MNSLRLNGLR KLPPGFRFQP TEEELVFQYL KCKAFSFPLP ASIIPDLNIC NFDPWDLPGE 60 LGEERYFFSM KEAKYKTGNR INRATASGYW KATGSDKQII SRRNQVAGMR KTLVFHMGKP 120 PHGLRTDWII NEYRLVNIPN NDFNLANNPM MQASLCI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
3swm_A	3e-39	12	137	20	147	NAC domain-containing protein 19
3swm_B	3e-39	12	137	20	147	NAC domain-containing protein 19
3swm_C	3e-39	12	137	20	147	NAC domain-containing protein 19
3swm_D	3e-39	12	137	20	147	NAC domain-containing protein 19
3swp_A	3e-39	12	137	20	147	NAC domain-containing protein 19
3swp_B	3e-39	12	137	20	147	NAC domain-containing protein 19
3swp_C	3e-39	12	137	20	147	NAC domain-containing protein 19
3swp_D	3e-39	12	137	20	147	NAC domain-containing protein 19
4dul_A	2e-39	12	137	17	144	NAC domain-containing protein 19
4dul_B	2e-39	12	137	17	144	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269\|PubMed:20388856}.
Uniprot	TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016695603.1	1e-112	PREDICTED: NAC domain-containing protein 83-like
Swissprot	Q9FY93	4e-63	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A1U8K3P1	1e-111	A0A1U8K3P1_GOSHI; NAC domain-containing protein 83-like
STRING	Gorai.007G043900.1	1e-109	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM22074	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	2e-65	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]