![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D01G0731 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 184aa MW: 19760.2 Da PI: 7.6249 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.5 | 8.4e-58 | 29 | 124 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdrflPianv+rimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+egek Gh_D01G0731 29 KEQDRFLPIANVGRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREMEGEK 124 79********************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.3E-54 | 23 | 131 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.66E-41 | 31 | 132 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.1E-28 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.7E-21 | 62 | 80 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.7E-21 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 8.7E-21 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MADSDSESGG AQNNASNAAG NNNHLFSPKE QDRFLPIANV GRIMKKALPA NAKISKEAKE 60 TVQECVSEFI SFITGEASDK CQKEKRKTIN GDDLLWAMTT LGFEDYVEPL KVYLQRFREM 120 EGEKTTVARD KDAPLVAASG GGGGGVYGMM VHQHQGHVYG STGFHQMGSG LGKGGPPNNL 180 GRPK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 29 | 119 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 29 | 119 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ527494 | 1e-132 | HQ527494.1 Gossypium herbaceum clone NBRI_B2_815 simple sequence repeat marker, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012461775.1 | 1e-136 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 3e-68 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A0D2QAI2 | 1e-135 | A0A0D2QAI2_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.002G099900.1 | 1e-136 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47640.1 | 2e-67 | nuclear factor Y, subunit B2 |
Publications ? help Back to Top | |||
---|---|---|---|
|