PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

LBD

Protein Properties

Length: 227aa MW: 24624.6 Da PI: 8.1319

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A11G2723	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	144.7	2.7e-45	12	111	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 +CaaCk+lrrkC+++Cv+apyfp +qp+kf nvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k Gh_A11G2723 12 PCAACKFLRRKCQPECVFAPYFPPDQPQKFVNVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLSCAK 109 7**********************************************************************************************999 PP DUF260 99 ee 100 +e Gh_A11G2723 110 SE 111 87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	27.201	11	112	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.5E-44	12	109	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MASSSSSSSN SPCAACKFLR RKCQPECVFA PYFPPDQPQK FVNVHKVFGA SNVTKLLNEL 60 HPSQREDAVN SLAYEADMRL RDPVYGCVGV ISLLQHQLRQ LQMDLSCAKS ELSKYQSLGI 120 TGHAGLIAAA AAATATTHQN LGINLIGNGG GGGGGGREHH FHHHQFFPRD HHHHHHHQQQ 180 MLMSFDASSN CDANLLAMNV SSGIGQLSQF QSPRAAAGDD RRTIHPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-55	2	115	1	114	LOB family transfactor Ramosa2.1
5ly0_B	3e-55	2	115	1	114	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves, flowers and adaxial domains of cotyledonary and leaves primordia. {ECO:0000269\|PubMed:12040093, ECO:0000269\|PubMed:12068116, ECO:0000269\|PubMed:17559509}.

Functional Description ? help Back to Top
Source	Description
UniProt	Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). Involved in leaf polarity establishment by functioning cooperatively with RH10 or RID2 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269\|PubMed:11311158, ECO:0000269\|PubMed:12787254, ECO:0000269\|PubMed:12874130, ECO:0000269\|PubMed:14508003, ECO:0000269\|PubMed:16006579, ECO:0000269\|PubMed:16699177, ECO:0000269\|PubMed:17395603, ECO:0000269\|PubMed:17559509, ECO:0000269\|PubMed:23271976, ECO:0000269\|PubMed:27334696}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269\|PubMed:11934861}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022744336.1	1e-120	LOB domain-containing protein 6-like
Swissprot	O04479	3e-93	AS2_ARATH; Protein ASYMMETRIC LEAVES 2
TrEMBL	A0A061EW96	1e-115	A0A061EW96_THECC; Lateral organ boundaries domain family protein
STRING	EOY08933	1e-116	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM12679	25	31

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65620.4	2e-75	LBD family protein

Publications ? help Back to Top
Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Mateo-Bonmatí E, et al. Plastid control of abaxial-adaxial patterning. Sci Rep, 2015. 5: p. 15975 [PMID:26522839] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Matsumura Y, et al. A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis. Biol Open, 2016. 5(7): p. 942-54 [PMID:27334696] Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094] Vial-Pradel S, et al. Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3). Plant Cell Physiol., 2018. 59(7): p. 1385-1397 [PMID:29415182] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]