PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A11G0348

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 186aa MW: 21419.5 Da PI: 10.0303

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A11G0348	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	145	4.1e-45	12	135	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrF+Pt+eelv +yLk k+ + +l++ ++i++++i++++PwdLp + +e yfFs ++ ky+ g+r n at+sgyWkatg+dk+++s++++ Gh_A11G0348 12 LPPGFRFQPTEEELVFQYLKCKAFSFPLPA-SIIPDLNICNFDPWDLPGDL---GEERYFFSVKEAKYKIGNRINWATASGYWKATGSDKQIISRRNQ 105 79**************************.89***********543...5799************************************ PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 + g++ktLvf+ g+ p+g +tdW+mheyrl Gh_A11G0348 106 VAGMRKTLVFHMGKPPHGLRTDWIMHEYRL 135 **************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.84E-49	8	143	IPR003441	NAC domain
PROSITE profile	PS51005	45.451	12	158	IPR003441	NAC domain
Pfam	PF02365	5.0E-23	13	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MNSLRLNGLR KLPPGFRFQP TEEELVFQYL KCKAFSFPLP ASIIPDLNIC NFDPWDLPGD 60 LGEERYFFSV KEAKYKIGNR INWATASGYW KATGSDKQII SRRNQVAGMR KTLVFHMGKP 120 PHGLRTDWIM HEYRLVNVPN NDFNSANNPM MQAKKFSIGS ATTQDNLDDD NAEDKKDKKK 180 KFLQKA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-39	12	137	17	144	NO APICAL MERISTEM PROTEIN
3swm_A	9e-39	12	137	20	147	NAC domain-containing protein 19
3swm_B	9e-39	12	137	20	147	NAC domain-containing protein 19
3swm_C	9e-39	12	137	20	147	NAC domain-containing protein 19
3swm_D	9e-39	12	137	20	147	NAC domain-containing protein 19
3swp_A	9e-39	12	137	20	147	NAC domain-containing protein 19
3swp_B	9e-39	12	137	20	147	NAC domain-containing protein 19
3swp_C	9e-39	12	137	20	147	NAC domain-containing protein 19
3swp_D	9e-39	12	137	20	147	NAC domain-containing protein 19
4dul_A	9e-39	12	137	17	144	NAC domain-containing protein 19
4dul_B	9e-39	12	137	17	144	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269\|PubMed:20388856}.
Uniprot	TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269\|PubMed:20388856, ECO:0000269\|PubMed:21673078, ECO:0000269\|PubMed:24442717}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269\|PubMed:21673078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016708953.1	1e-114	PREDICTED: NAC domain-containing protein 83-like
Swissprot	Q9FY93	2e-63	NAC83_ARATH; NAC domain-containing protein 83
TrEMBL	A0A1U8L6E2	1e-112	A0A1U8L6E2_GOSHI; NAC domain-containing protein 83-like
STRING	Gorai.007G043900.1	1e-107	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM22074	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13180.1	1e-65	NAC domain containing protein 83

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]