 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Gh_A10G1445 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
| Family |
M-type_MADS |
| Protein Properties |
Length: 106aa MW: 12120.4 Da PI: 10.5438 |
| Description |
M-type_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Gh_A10G1445 | genome | NAU-NBI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 42.6 | 8e-14 | 11 | 50 | 3 | 42 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
i n+s r+ t+ +R +g+ KK +E+S+LC+++ + i++s+
Gh_A10G1445 11 ITNNSARKATYKNRMKGLTKKMSEMSTLCGVDTCAIMYSP 50
89*************************************8 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
