PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A05G0292 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 190aa MW: 21886.7 Da PI: 8.4766 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.2 | 8.9e-19 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd++l+++v+ +G+++W ++a++ g++R++k+c++rw +yl Gh_A05G0292 18 RGAWTGEEDQKLAQVVEIYGPKRWQAVAAKAGLNRSGKSCRLRWMNYL 65 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.9 | 3.6e-16 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_A05G0292 71 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.928 | 13 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.26E-30 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.7E-17 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-18 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-24 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.07E-12 | 20 | 65 | No hit | No description |
SMART | SM00717 | 1.9E-15 | 70 | 118 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.215 | 70 | 120 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.5E-14 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-25 | 73 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.24E-10 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MPVAPPISTK CSKKEVNRGA WTGEEDQKLA QVVEIYGPKR WQAVAAKAGL NRSGKSCRLR 60 WMNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKT 120 KQNEKQTIGS RMQESVLENC KVSESKRDEN STACFINGDD SLFDCYSEEP LNLEWTSHFF 180 ETDELWLNLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-31 | 15 | 120 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 3e-31 | 15 | 120 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX582297 | 1e-50 | JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016752574.1 | 1e-140 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | P10290 | 6e-50 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A1U8PQP8 | 1e-139 | A0A1U8PQP8_GOSHI; transcription factor MYB114-like | ||||
STRING | Gorai.009G040900.1 | 1e-136 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 9e-52 | myb domain protein 5 |