PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01036090001 | ||||||||
Common Name | LOC100263868, VIT_06s0080g00790 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 226aa MW: 25624.6 Da PI: 8.4513 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23.5 | 1.3e-07 | 15 | 60 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 +W+ d+l+ +a + + +W++Ia+ ++ g++ +++ ++ + GSVIVT01036090001 15 SWSRHQDKLFERALVVIPEEtpdRWDKIAAQVP-GKSSSEVRRHYED 60 7*****************99*************.***********76 PP | |||||||
2 | Myb_DNA-binding | 43 | 1e-13 | 114 | 158 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r Rt+ q+ s+ qky GSVIVT01036090001 114 PWTEEEHRLFLIGLQRYGKGDWRSISRNAVVSRTPTQVASHAQKY 158 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 4.45E-11 | 9 | 63 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-7 | 12 | 64 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.737 | 14 | 62 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 7.4E-6 | 15 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 0.00155 | 21 | 62 | No hit | No description |
PROSITE profile | PS51294 | 19.255 | 107 | 163 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.22E-17 | 109 | 163 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.5E-17 | 110 | 161 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 6.5E-10 | 111 | 161 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-12 | 111 | 158 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.5E-11 | 114 | 158 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.70E-9 | 114 | 159 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MMMVNQSPSP SSSSSWSRHQ DKLFERALVV IPEETPDRWD KIAAQVPGKS SSEVRRHYED 60 LVHDVAEIDS GRVELPLYED ESCGSPWASD SRAGQVSFSP RPRQSESERK KGVPWTEEEH 120 RLFLIGLQRY GKGDWRSISR NAVVSRTPTQ VASHAQKYFM RLTSGKKDKK RSSIHDITTV 180 DTSNSLPHSN TQTWVGESLA SQIPYYEEGP PSFGFSILKW NMWKV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 5e-15 | 11 | 78 | 6 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.23727 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM431329 | 0.0 | AM431329.2 Vitis vinifera contig VV78X228264.5, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002273261.1 | 1e-158 | PREDICTED: transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 4e-61 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | F6HHE1 | 1e-157 | F6HHE1_VITVI; Uncharacterized protein | ||||
STRING | VIT_06s0080g00790.t01 | 1e-157 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-70 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01036090001 |
Entrez Gene | 100263868 |
Publications ? help Back to Top | |||
---|---|---|---|
|