PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01032088001 | ||||||||
Common Name | VIT_13s0064g00960 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 290aa MW: 32531.3 Da PI: 5.0227 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.9 | 5.5e-09 | 7 | 36 | 19 | 48 |
TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48 G g+W+ Iar g+ R++k+c++rw +yl GSVIVT01032088001 7 NGQGCWSDIARNAGLQRCGKSCRLRWINYL 36 68889***********************97 PP | |||||||
2 | Myb_DNA-binding | 52.2 | 1.4e-16 | 42 | 85 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+++++E+el+++++ lG++ W+ Ia++++ gRt++++k++w++ GSVIVT01032088001 42 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 85 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.96 | 1 | 36 | IPR017930 | Myb domain |
SMART | SM00717 | 68 | 2 | 38 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-16 | 2 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.17E-21 | 5 | 83 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.7E-7 | 6 | 36 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.35E-4 | 8 | 36 | No hit | No description |
PROSITE profile | PS51294 | 25.699 | 37 | 91 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-16 | 41 | 89 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.3E-15 | 42 | 85 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-26 | 44 | 92 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.57E-11 | 44 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:1901348 | Biological Process | positive regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 290 aa Download sequence Send to blast |
MSYMLRNGQG CWSDIARNAG LQRCGKSCRL RWINYLRPDL KRGAFSPQEE ELIIHLHSIL 60 GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR LKNSLQTHSP NDCHDSSLEP RVVVDNINAM 120 GMGVGGSSGM LLSMHEHEMM NMYMDSSSSS FSSMNTMLTS NHLDNPFPLL DNRHDQMVFS 180 LPNCMAKPEM TDEFDGRYGV TGGGNMGVER EISIPGSQSN STTEENNGAT QNEYYTIDMK 240 NNNSKVEESD NIFGVGNHWQ GENMGIGEWD LEGLLENASS FPFLDFQLQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-22 | 1 | 91 | 19 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed specifically in fiber and vessel cells that are undergoing secondary wall thickening in floral stems. Expressed in vessels but not in xylary fibers in the developing secondary xylem of roots. {ECO:0000269|PubMed:19808805}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM438915 | 0.0 | AM438915.1 Vitis vinifera contig VV78X120994.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002275467.2 | 0.0 | PREDICTED: transcription factor MYB46 | ||||
Swissprot | Q9C6U1 | 1e-68 | MYB83_ARATH; Transcription factor MYB83 | ||||
TrEMBL | A0A438J1L7 | 0.0 | A0A438J1L7_VITVI; Transcription factor MYB83 | ||||
TrEMBL | D7T301 | 0.0 | D7T301_VITVI; Uncharacterized protein | ||||
STRING | VIT_13s0064g00960.t01 | 0.0 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12870.1 | 3e-59 | myb domain protein 46 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01032088001 |
Publications ? help Back to Top | |||
---|---|---|---|
|