PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01026468001 | ||||||||
Common Name | VIT_04s0044g01500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 199aa MW: 22707.4 Da PI: 4.1292 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 117.7 | 1.1e-36 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGf+F Ptdeelv ++L +k++ ++ ++i+++d y ++Pw+L k+ ++ ++wyfFs++ + ratk+gyWk+ d+++ GSVIVT01026468001 8 LPPGFQFYPTDEELVLDFLYRKASLLPCYP-NIIPDLDSYVHDPWELSGKALSSGNQWYFFSQKT--------QDRATKNGYWKQLDIDEAI 90 79*************************888.89**************977778899******975........4799*************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ g++vg+kk L fy g+ap+g +t+W+m+ey+l GSVIVT01026468001 91 YTSAGKKVGIKKYLLFYMGEAPEGIETNWIMQEYSL 126 **********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-44 | 5 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 43.056 | 8 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-21 | 9 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MEEGSINLPP GFQFYPTDEE LVLDFLYRKA SLLPCYPNII PDLDSYVHDP WELSGKALSS 60 GNQWYFFSQK TQDRATKNGY WKQLDIDEAI YTSAGKKVGI KKYLLFYMGE APEGIETNWI 120 MQEYSLSNSG LGCTSYKRIA GKKILDGVEW VLCRVYERKS SQHGFWCDED DDDGTELSCL 180 DEIFLSLDDD LDEISLPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-38 | 6 | 163 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-38 | 6 | 163 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-38 | 6 | 163 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-38 | 6 | 163 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-38 | 6 | 163 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-38 | 6 | 163 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-38 | 6 | 163 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in root xylem vessels (PubMed:15923329). Expressed in stems, vascular tissue of cauline leaves and tracheary elements of sepals (PubMed:18069942). {ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:18069942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM430630 | 1e-150 | AM430630.2 Vitis vinifera contig VV78X091730.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002264894.3 | 1e-145 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 2e-73 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | D7U4C6 | 1e-144 | D7U4C6_VITVI; Uncharacterized protein | ||||
STRING | VIT_04s0044g01500.t01 | 1e-145 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP4510 | 10 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 9e-66 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01026468001 |
Publications ? help Back to Top | |||
---|---|---|---|
|