PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01025648001 | ||||||||
Common Name | LOC100241470, VIT_08s0040g02220 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 90aa MW: 10132.1 Da PI: 10.2814 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 124.8 | 2.8e-39 | 22 | 89 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 v+ +eakG+nPGlivll+v g+llvflvgn++ly+yaqk+lP kkkPvskkk+kre+lkqGv++PGe GSVIVT01025648001 22 VKDAEAKGFNPGLIVLLLVVGVLLVFLVGNFLLYMYAQKTLPRMKKKPVSKKKMKRERLKQGVSAPGE 89 6789***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 3.1E-38 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MDDEFEFAEK VPPSFDRMEN MVKDAEAKGF NPGLIVLLLV VGVLLVFLVG NFLLYMYAQK 60 TLPRMKKKPV SKKKMKRERL KQGVSAPGE* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.12940 | 1e-149 | flower| fruit| inflorescence| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM454172 | 1e-118 | AM454172.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X099447.7, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002279933.1 | 2e-57 | PREDICTED: DNA-binding protein S1FA | ||||
Swissprot | P42553 | 3e-16 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
TrEMBL | A0A438IPU2 | 4e-56 | A0A438IPU2_VITVI; DNA-binding protein S1FA1 | ||||
TrEMBL | D7TQI4 | 4e-56 | D7TQI4_VITVI; Uncharacterized protein | ||||
STRING | VIT_08s0040g02220.t01 | 6e-57 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5095 | 13 | 22 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01025648001 |
Entrez Gene | 100241470 |