PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01025539001 | ||||||||
Common Name | VIT_08s0040g03260 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17580.6 Da PI: 6.117 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177.4 | 1.3e-55 | 24 | 117 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 vreqdrflPian+srimkk+lPan+ki+kdake++qecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+ yre GSVIVT01025539001 24 VREQDRFLPIANISRIMKKALPANGKIAKDAKEIMQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKLYLAAYRE 115 69*****************************************************************************************9 PP NF-YB 93 le 94 + GSVIVT01025539001 116 GD 117 65 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.4E-53 | 21 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.3E-40 | 27 | 154 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.5E-20 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.5E-20 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 9.5E-20 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MADAAASPGE GSHESGEQIP HSNVREQDRF LPIANISRIM KKALPANGKI AKDAKEIMQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKLYL AAYREGDTKG 120 PAKGGDGPAR KDAAGAQSSI NSHISHQGPY TQNVNYETPQ R* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-47 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-47 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM435225 | 1e-117 | AM435225.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X240850.2, clone ENTAV 115. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019076948.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Refseq | XP_019076949.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X1 | ||||
Swissprot | Q8VYK4 | 8e-76 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | D7TQ96 | 1e-117 | D7TQ96_VITVI; Uncharacterized protein | ||||
STRING | VIT_08s0040g03260.t01 | 1e-118 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 3e-78 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01025539001 |
Publications ? help Back to Top | |||
---|---|---|---|
|