PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01015900001 | ||||||||
Common Name | LOC100255279, VIT_03s0017g02280 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 270aa MW: 30258.1 Da PI: 7.7062 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 108.5 | 3.5e-34 | 23 | 77 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl GSVIVT01015900001 23 KPRLRWTTELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 77 79****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-32 | 20 | 78 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.636 | 20 | 80 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.94E-17 | 22 | 78 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.1E-24 | 23 | 78 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 6.2E-9 | 25 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 2.9E-25 | 121 | 168 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 270 aa Download sequence Send to blast |
MHSHDRPLSA QGDSGLVLTT DPKPRLRWTT ELHERFVDAV AQLGGPDKAT PKTIMRVMGV 60 KGLTLYHLKS HLQKFRLGKQ PHKDFNDQAV KDGEKASALG NQRNATPTPV LMGRNINDRN 120 MHFNEALRMQ MEVRRRLNEQ LEVQRHLQMR IDAQGKYMQT ILEKACQTLT GKNGDCQSYH 180 GVGNQGYTEV GSMKDFSSSV NFPCLEDLHI YGERPNPYDS SKAPIIWSND MQLLQEVGTA 240 AACIPSQEDA FKSYLKQHHE EESSGSGEA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 5e-19 | 23 | 79 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 5e-19 | 23 | 79 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 5e-19 | 23 | 79 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 5e-19 | 23 | 79 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.19363 | 0.0 | inflorescence |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:26239308}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM484909 | 1e-180 | AM484909.1 Vitis vinifera contig VV78X225435.4, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002264275.3 | 0.0 | PREDICTED: myb family transcription factor APL isoform X3 | ||||
Swissprot | Q9SAK5 | 3e-84 | APL_ARATH; Myb family transcription factor APL | ||||
TrEMBL | D7TUH0 | 0.0 | D7TUH0_VITVI; Uncharacterized protein | ||||
STRING | VIT_03s0017g02280.t01 | 0.0 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP78 | 17 | 262 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79430.2 | 2e-86 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01015900001 |
Entrez Gene | 100255279 |
Publications ? help Back to Top | |||
---|---|---|---|
|