PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01014154001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 107aa MW: 11846.5 Da PI: 10.2377 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 194.9 | 2.8e-60 | 3 | 102 | 2 | 101 |
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 ++ r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sasasp+ss GSVIVT01014154001 3 SGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIVGGSASASPCSS 94 789***************************************************************************************** PP DUF822 94 lqsslkss 101 ++ s++s GSVIVT01014154001 95 YHPSPSSP 102 **887775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 2.0E-57 | 4 | 104 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MTSGARLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG 60 WTVEPDGTTY RKGCKPVERM DIVGGSASAS PCSSYHPSPS SPSIHP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 8e-25 | 6 | 77 | 372 | 443 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.21849 | 1e-163 | bud| flower |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM426448 | 1e-114 | AM426448.2 Vitis vinifera contig VV78X198422.9, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010644097.1 | 2e-67 | PREDICTED: BES1/BZR1 homolog protein 4 | ||||
Swissprot | Q9ZV88 | 1e-43 | BEH4_ARATH; BES1/BZR1 homolog protein 4 | ||||
TrEMBL | A0A067DLE1 | 2e-65 | A0A067DLE1_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A2H5Q4X7 | 2e-65 | A0A2H5Q4X7_CITUN; Uncharacterized protein | ||||
TrEMBL | F6H1V6 | 2e-61 | F6H1V6_VITVI; Uncharacterized protein | ||||
TrEMBL | V4TV52 | 2e-65 | V4TV52_9ROSI; Uncharacterized protein | ||||
STRING | XP_006477843.1 | 3e-66 | (Citrus sinensis) | ||||
STRING | VIT_19s0014g00870.t01 | 3e-62 | (Vitis vinifera) | ||||
STRING | XP_006442380.1 | 3e-66 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP1595 | 15 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G78700.1 | 2e-34 | BES1/BZR1 homolog 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01014154001 |