![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01014093001 | ||||||||
Common Name | VIT_19s0014g00310 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 79aa MW: 9168.73 Da PI: 10.8531 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 73 | 2.5e-23 | 9 | 58 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ien+++rq+tfskR+ ++ KA+E+S+LCd++va++ +s++g+l +++ GSVIVT01014093001 9 KIENTTRRQITFSKRKSSLIRKANEISILCDVDVALLTYSPSGRLNKFCN 58 69*********************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.2E-25 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 23.661 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-20 | 2 | 22 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.01E-25 | 3 | 77 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-21 | 9 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-20 | 22 | 37 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-20 | 37 | 58 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MGRKIEMRKI ENTTRRQITF SKRKSSLIRK ANEISILCDV DVALLTYSPS GRLNKFCNRD 60 RMEDVIKSYI NLSPAKRY* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM427782 | 2e-90 | AM427782.1 Vitis vinifera contig VV78X192676.7, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019072654.1 | 5e-47 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X1 | ||||
Swissprot | Q1PFC2 | 7e-25 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
TrEMBL | E0CS08 | 3e-49 | E0CS08_VITVI; Uncharacterized protein | ||||
STRING | VIT_19s0014g00310.t01 | 5e-50 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77980.1 | 3e-27 | AGAMOUS-like 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01014093001 |
Publications ? help Back to Top | |||
---|---|---|---|
|