PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01010152001 | ||||||||
Common Name | LOC100258132, VIT_01s0010g00930 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 196aa MW: 22353.9 Da PI: 6.5103 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.1 | 2.5e-15 | 81 | 138 | 5 | 62 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +++rr+++NRe+ArrsR RK++ ++eL v L +eN++L+++l++ ++ +++ +e GSVIVT01010152001 81 RKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENHSLIDKLNHVSECHDRVLQE 138 79********************************************999877666665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.5E-16 | 77 | 141 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.668 | 79 | 130 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.9E-13 | 81 | 154 | No hit | No description |
Pfam | PF00170 | 7.3E-13 | 81 | 138 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.0E-13 | 81 | 130 | No hit | No description |
CDD | cd14702 | 3.42E-21 | 82 | 133 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 84 | 99 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MLPGEFTGIH YMAPENPTPF PANFGMTYDN TPTLHFGGYL SNLTTSQIPP IHEFTPQSSS 60 LSNNSTSDEA EEHQLSIIDE RKQRRMISNR ESARRSRMRK QKHLDELWSQ VVRLRNENHS 120 LIDKLNHVSE CHDRVLQENV RLKEEASDLR QMLTDLRIGS PYTTLRELEG VSCNTAHLRA 180 ESSNQSITSS IDLLH* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 93 | 100 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM457581 | 0.0 | AM457581.2 Vitis vinifera contig VV78X004271.7, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002269495.1 | 1e-144 | PREDICTED: basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 6e-40 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | D7TAA5 | 1e-142 | D7TAA5_VITVI; Uncharacterized protein | ||||
STRING | VIT_01s0010g00930.t01 | 1e-143 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3104 | 11 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 6e-45 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01010152001 |
Entrez Gene | 100258132 |
Publications ? help Back to Top | |||
---|---|---|---|
|