PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01009841001 | ||||||||
Common Name | LOC100262483, VIT_18s0001g13710 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 108aa MW: 12299 Da PI: 8.5206 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 58.6 | 2.9e-18 | 22 | 98 | 18 | 94 |
GAGA_bind 18 aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasa 94 ++ + qlm+++aerda+i+ernlalsekka++a+rd a l+rd+a+ er++al+erdn + +l ++ ns++s GSVIVT01009841001 22 WLMQPQTMEQLMAILAERDAAIQERNLALSEKKAVLAQRDLAILERDAAIVERDNALLERDNVISTLRYRGNSMNSC 98 456777788*************************************************************9998754 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 5.7E-9 | 19 | 91 | IPR010409 | GAGA-binding transcriptional activator |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MGGDREIRRE KVHPHGTTQN QWLMQPQTME QLMAILAERD AAIQERNLAL SEKKAVLAQR 60 DLAILERDAA IVERDNALLE RDNVISTLRY RGNSMNSCNW GKRKENA* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.18596 | 0.0 | bud| fruit| inflorescence |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ386728 | 1e-169 | FQ386728.1 Vitis vinifera clone SS0AEB28YO17. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003634376.1 | 1e-73 | PREDICTED: protein BASIC PENTACYSTEINE6 isoform X5 | ||||
Refseq | XP_010664776.1 | 1e-73 | PREDICTED: protein BASIC PENTACYSTEINE6 isoform X5 | ||||
Refseq | XP_010664777.1 | 1e-73 | PREDICTED: protein BASIC PENTACYSTEINE6 isoform X5 | ||||
Swissprot | Q8L999 | 8e-30 | BPC6_ARATH; Protein BASIC PENTACYSTEINE6 | ||||
TrEMBL | E0CPJ5 | 3e-72 | E0CPJ5_VITVI; Uncharacterized protein | ||||
STRING | VIT_18s0001g13710.t01 | 5e-73 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP2841 | 13 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42520.1 | 3e-32 | basic pentacysteine 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01009841001 |
Entrez Gene | 100262483 |