 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
GSVIVT01008980001 |
Common Name | VIT_18s0001g04810 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
Family |
M-type_MADS |
Protein Properties |
Length: 98aa MW: 11538.4 Da PI: 9.901 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
GSVIVT01008980001 | genome | Genoscope | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 77.6 | 9.3e-25 | 10 | 58 | 2 | 50 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
rie+k rqv+fs+R++g++KKA+ELSvLCd+++a+i+f ++g+l +s
GSVIVT01008980001 10 RIEDKATRQVSFSRRKKGLIKKAYELSVLCDIDIALIMFPPSGRLTQFS 58
8*********************************************997 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6byy_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 3e-18 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
6c9l_A | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-18 | 1 | 86 | 1 | 85 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AM486084 | 7e-97 | AM486084.2 Vitis vinifera contig VV78X084760.4, whole genome shotgun sequence. |
Orthologous Group
? help Back to Top |
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP16 | 17 | 761 |