PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01005342001 | ||||||||
Common Name | VIT_00s1624g00010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 94aa MW: 11133.2 Da PI: 11.6886 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 106.1 | 2e-33 | 33 | 86 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 prlrWtp+LH++Fv+ave+LGG+++AtPk il++m+vkgL+++h+kSHLQ+YR+ GSVIVT01005342001 33 PRLRWTPDLHRCFVHAVERLGGEDRATPKMILQIMDVKGLSISHIKSHLQMYRS 86 8****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.163 | 29 | 89 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-32 | 29 | 88 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.97E-16 | 31 | 87 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.6E-25 | 33 | 87 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.7E-8 | 34 | 85 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009010 | anatomy | seed | ||||
PO:0025501 | developmental stage | fruit formation stage | ||||
PO:0025502 | developmental stage | fruit ripening stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MRTLRRPRRL DSLLSDISLK SSMVRPYVRS KLPRLRWTPD LHRCFVHAVE RLGGEDRATP 60 KMILQIMDVK GLSISHIKSH LQMYRSMKHE QIVQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 2e-21 | 34 | 89 | 3 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 2e-21 | 34 | 89 | 3 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 2e-21 | 34 | 89 | 3 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 2e-21 | 34 | 89 | 3 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM474068 | 3e-80 | AM474068.2 Vitis vinifera contig VV78X087148.3, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010647532.1 | 3e-62 | PREDICTED: putative two-component response regulator ARR21 | ||||
Swissprot | Q700D9 | 4e-30 | MYBF_ARATH; Putative Myb family transcription factor At1g14600 | ||||
TrEMBL | A0A438JGK0 | 9e-61 | A0A438JGK0_VITVI; Putative Myb family transcription factor | ||||
TrEMBL | F6H8E3 | 2e-61 | F6H8E3_VITVI; Uncharacterized protein (Fragment) | ||||
STRING | VIT_00s1624g00010.t01 | 3e-62 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP285 | 15 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02060.1 | 7e-35 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01005342001 |