PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSVIVT01001940001 | ||||||||
Common Name | LOC100266389, VIT_13s0175g00120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 223aa MW: 25063.6 Da PI: 9.9308 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 50.9 | 3.4e-16 | 152 | 202 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++L+k +el+k+ GSVIVT01001940001 152 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRK-RKELEKML 202 79****************************************5.57888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.1E-14 | 143 | 200 | No hit | No description |
PRINTS | PR00041 | 8.6E-5 | 147 | 163 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 1.6E-12 | 148 | 216 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.691 | 150 | 195 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.81E-11 | 152 | 197 | No hit | No description |
CDD | cd14707 | 1.50E-22 | 152 | 206 | No hit | No description |
Pfam | PF00170 | 1.3E-13 | 152 | 200 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 155 | 170 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00041 | 8.6E-5 | 165 | 185 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 8.6E-5 | 185 | 202 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MYSLTLDEVQ NQLGDLGKPL TSMNLDELLK NVWTPSLSLT GALSKKTVDE VWRDIQGHGK 60 NSEEKKSRER QPTLGEMTLE DFLVKAGVVA EPSDKKIAGT PLPMGPSSVM DVTYPDNQVA 120 LSSPLMGALS DTQAPGRKRV SQEDMIEKTV ERRQKRMIKN RESAARSRAR KQAYTNELEN 180 KVSRLEEENE RLRKRKELEK MLPSAPPPEP KYQLRRTSSA PF* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Vvi.24690 | 0.0 | cell culture| flower| fruit |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}. | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00409 | DAP | Transfer from AT3G56850 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM469708 | 1e-114 | AM469708.2 Vitis vinifera contig VV78X277820.7, whole genome shotgun sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002265747.1 | 1e-145 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1 | ||||
Swissprot | Q9LES3 | 9e-84 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | F6I758 | 1e-144 | F6I758_VITVI; Uncharacterized protein | ||||
STRING | VIT_13s0175g00120.t01 | 1e-144 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP540 | 15 | 80 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 2e-72 | ABA-responsive element binding protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GSVIVT01001940001 |
Entrez Gene | 100266389 |
Publications ? help Back to Top | |||
---|---|---|---|
|