![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_AchrUn_randomP24680_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 219aa MW: 24981.5 Da PI: 10.2472 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 150.2 | 9.8e-47 | 15 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratks 80 lppGfrFhP+deelvv+yLk+kv + +l++ +i+++d+ k++Pw+Lp ++ + e yfF r+++y++gkr+nra++s GSMUA_AchrUn_randomP24680_001 15 LPPGFRFHPSDEELVVQYLKRKVFSCPLPA-FFIPDIDLRKHDPWNLPGAC---QGERYFFNLRKSRYPNGKRSNRAASS 90 79**************************99.67***************443...4589********************** PP NAM 81 gyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 gyWkatgkdk+++++ +++vg+kk+L+fy+g+ p g++tdW+mhey+l GSMUA_AchrUn_randomP24680_001 91 GYWKATGKDKQIVASgCNQVVGIKKVLIFYRGKLPAGSRTDWIMHEYSL 139 *************9977889***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.31E-54 | 8 | 174 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.543 | 15 | 174 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-24 | 16 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MDHKPSPVRC GALRLPPGFR FHPSDEELVV QYLKRKVFSC PLPAFFIPDI DLRKHDPWNL 60 PGACQGERYF FNLRKSRYPN GKRSNRAASS GYWKATGKDK QIVASGCNQV VGIKKVLIFY 120 RGKLPAGSRT DWIMHEYSLA GSDNPALIFP QRKNSTHGMM VPNQDWVLCR IFKKRRTTNM 180 VDEIEQDRDE GKIRSSAAGF IDFMQQRESD QTPSSSSSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-50 | 13 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-50 | 13 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-50 | 13 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-50 | 13 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 5e-50 | 13 | 179 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 5e-50 | 13 | 179 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 5e-50 | 13 | 179 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009388267.1 | 1e-165 | PREDICTED: NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 3e-70 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | M0UC26 | 1e-163 | M0UC26_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_AchrUn_randomP24680_001 | 1e-164 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6317 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-72 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|