![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P28050_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 157aa MW: 17118.5 Da PI: 7.3459 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.3 | 1.3e-54 | 29 | 121 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 reqdrflPian++rim+k++P+n+ki+kdake+vqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+yveplk+yl+ GSMUA_Achr8P28050_001 29 REQDRFLPIANIGRIMRKAIPENGKIAKDAKESVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEEYVEPLKLYLQL 116 89************************************************************************************** PP NF-YB 90 yrele 94 yre++ GSMUA_Achr8P28050_001 117 YREVN 121 ***85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.8E-50 | 26 | 121 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.02E-37 | 31 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-28 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-20 | 62 | 80 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.0E-20 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 1.0E-20 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MAESGVPGSP ESGHSGDHGG GGGGGASARE QDRFLPIANI GRIMRKAIPE NGKIAKDAKE 60 SVQECVSEFI SFITSEASDK CQREKRKTIN GDDLLWAMGT LGFEEYVEPL KLYLQLYREV 120 NLLPSLPYFN TGTPFCRAVL IGGIASLFLR LLLRNRT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 9e-49 | 27 | 119 | 1 | 93 | NF-YB |
4awl_B | 1e-48 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-48 | 27 | 119 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009415144.1 | 2e-83 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Refseq | XP_009415145.1 | 2e-83 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O23310 | 3e-58 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | M0TUA8 | 1e-111 | M0TUA8_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P28050_001 | 1e-112 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-57 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|