![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P21910_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 118aa MW: 13176.9 Da PI: 8.3316 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 122.7 | 1.5e-38 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 mkk+lP nakisk+aket+qec+sefi+f+t+ea+d cq+++rktingdd++ a+ tlG++dy+++++ yl++y+e e++ GSMUA_Achr8P21910_001 1 MKKALPPNAKISKQAKETMQECASEFIGFITGEAADSCQKNNRKTINGDDICAAMKTLGLDDYADAMRRYLHRYKEHEEK 80 9***************************************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 1.6E-19 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 5.9E-36 | 1 | 86 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.86E-28 | 1 | 84 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 9.0E-13 | 19 | 37 | No hit | No description |
PRINTS | PR00615 | 9.0E-13 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 9.0E-13 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MKKALPPNAK ISKQAKETMQ ECASEFIGFI TGEAADSCQK NNRKTINGDD ICAAMKTLGL 60 DDYADAMRRY LHRYKEHEEK ATSRDHNKIA CIDVVDELSV SKTSSSRRHL FPTNPSVG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-30 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009414194.1 | 2e-84 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 1e-34 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O82248 | 2e-34 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | M0TSJ4 | 1e-83 | M0TSJ4_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P21910_001 | 2e-84 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 4e-37 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|