PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr8P04340_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 151aa MW: 17159.8 Da PI: 8.5012 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 52.9 | 1.5e-16 | 2 | 70 | 2 | 70 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee 70 d++ e++Cyv+C++Cnt+lav vP+ l+ vtv CGhC +l ++ +q + shl+ sl+ + GSMUA_Achr8P04340_001 2 DLVCPIEHLCYVRCTYCNTLLAVGVPFRWLMDRVTVNCGHCHHLSFLSPGDVVQCICPISHLQMSLQGP 70 5667789***********************************998888889999999999999888766 PP | |||||||
2 | YABBY | 69.3 | 1.4e-21 | 102 | 142 | 122 | 162 |
YABBY 122 rqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162 + r+Psayn f++eeiqrika+ Pdi hreafs+aaknWa GSMUA_Achr8P04340_001 102 KHRAPSAYNHFMREEIQRIKAAKPDIPHREAFSMAAKNWAN 142 68*************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.6E-35 | 7 | 142 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.83E-7 | 92 | 145 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 5.7E-5 | 104 | 143 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MDLVCPIEHL CYVRCTYCNT LLAVGVPFRW LMDRVTVNCG HCHHLSFLSP GDVVQCICPI 60 SHLQMSLQGP CFGSRREPPS LRRSSTSGEQ FKKAPFVLYD VKHRAPSAYN HFMREEIQRI 120 KAAKPDIPHR EAFSMAAKNW ANSDPRNSSD V |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018685534.1 | 3e-96 | PREDICTED: protein DROOPING LEAF-like | ||||
Swissprot | Q76EJ0 | 4e-61 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | M0TMI7 | 1e-110 | M0TMI7_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr8P04340_001 | 1e-111 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5951 | 36 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 6e-39 | YABBY family protein |