![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr7P15150_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 181aa MW: 19429.2 Da PI: 10.327 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 127 | 5.5e-40 | 73 | 133 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +e+alkcprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n++++ GSMUA_Achr7P15150_001 73 PEQALKCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNRRTK 133 7899******************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-33 | 57 | 131 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.9E-33 | 75 | 131 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.711 | 77 | 131 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 79 | 115 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MVFPSLPVYV DPPNWNQPHQ RGSSSHGGGD EDPHLPAPPP GLVGVPPAEA GMVCSIRPEL 60 TAERARLAKV AQPEQALKCP RCDSTNTKFC YFNNYSLSQP RHFCKACRRY WTRGGALRNV 120 PVGGGCRRNR RTKSTGSASS KPSVASATRQ GGGATMTSLA LQPPPPLVTS LAALMLHLFI 180 Q |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 117 | 130 | RNVPVGGGCRRNRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements. Triggers the transcription of HD-ZIP III genes, especially in the central domain of vascular tissue (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:30626969}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin in procambium. Antagonized by the HD-ZIP III proteins and by mobile miR165 and miR166 microRNAs. {ECO:0000269|PubMed:30626969}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC083942 | 4e-50 | AC083942.8 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0002D01, from chromosome 3, complete sequence. | |||
GenBank | AC137698 | 4e-50 | AC137698.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0014A21, from chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009409716.1 | 1e-111 | PREDICTED: dof zinc finger protein DOF5.1-like | ||||
Swissprot | O80928 | 1e-44 | DOF24_ARATH; Dof zinc finger protein DOF2.4 | ||||
TrEMBL | M0THQ2 | 1e-130 | M0THQ2_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr7P15150_001 | 1e-131 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP140 | 37 | 367 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37590.1 | 7e-47 | DNA binding with one finger 2.4 |
Publications ? help Back to Top | |||
---|---|---|---|
|