![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr4P18180_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 146aa MW: 16900.4 Da PI: 9.2886 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.4 | 1.8e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++lv +++q+G g+W++ ++ g+ R++k+c++rw +yl GSMUA_Achr4P18180_001 14 RGSWTPEEDQILVAYIRQHGHGNWRALPKQAGLLRCGKSCRLRWVNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 54.9 | 2e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE+e ++++++ +G++ W++Ia +++ gRt++++k+ w+++l GSMUA_Achr4P18180_001 67 RGNFTKEEEETIIRLHEDYGNR-WSAIATKLP-GRTDNEIKNVWHTHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.425 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.52E-31 | 10 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.1E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.37E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.132 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-27 | 65 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.6E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.5E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.03E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MVRAPCCEKM GLKRGSWTPE EDQILVAYIR QHGHGNWRAL PKQAGLLRCG KSCRLRWVNY 60 LRPDIKRGNF TKEEEETIIR LHEDYGNRWS AIATKLPGRT DNEIKNVWHT HLKKLLDLLG 120 ASDSGDKDFW LRVFMGAGDL QELSQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-25 | 12 | 117 | 5 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009396976.1 | 1e-82 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q7XBH4 | 1e-72 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | M0SPY1 | 1e-105 | M0SPY1_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr4P18180_001 | 1e-105 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 3e-71 | myb domain protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|