![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSMUA_Achr3P20450_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 94aa MW: 10821.1 Da PI: 9.0637 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.5 | 5e-32 | 8 | 66 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 l+Dg++WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver++edp++v++tYeg Hnh GSMUA_Achr3P20450_001 8 LNDGFKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDREDPSYVITTYEGIHNHM 66 58********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 4.9E-32 | 2 | 68 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.14E-28 | 3 | 68 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.813 | 3 | 68 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.4E-35 | 8 | 67 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-25 | 9 | 65 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MKSEVEVLND GFKWRKYGKK SVKNSPNPRN YYRCSTEGCS VKKRVERDRE DPSYVITTYE 60 GIHNHMSPGV VYYTTQDSVS GRYYVAGCQV PPDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-25 | 3 | 68 | 12 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 4e-25 | 3 | 68 | 12 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009393635.2 | 4e-65 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-35 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | M0SGB1 | 4e-63 | M0SGB1_MUSAM; Uncharacterized protein | ||||
STRING | GSMUA_Achr3P20450_001 | 6e-64 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 8e-38 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|