![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00156118001 | ||||||||
Common Name | GSBRNA2T00156118001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 93aa MW: 10653.6 Da PI: 10.2342 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 50.5 | 6.1e-16 | 17 | 73 | 44 | 100 |
DUF260 44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 k+l+++++++r++ ++sl++eAear+rdPvyG+vg+i+ lq++ ++l+ l+ +k+e GSBRNA2T00156118001 17 KILNEIDPSQRQACVDSLCFEAEARIRDPVYGCVGIIRGLQRRRQHLQLSLNIAKRE 73 899*********************************************999998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 10.165 | 1 | 74 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.3E-15 | 17 | 71 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MEPCAICKEK RQKCTKKILN EIDPSQRQAC VDSLCFEAEA RIRDPVYGCV GIIRGLQRRR 60 QHLQLSLNIA KRELAMIKHG QIQQHLSVRS RL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-16 | 3 | 82 | 11 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-16 | 3 | 82 | 11 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00156118001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024634719.1 | 1e-19 | LOB domain-containing protein 11 | ||||
Swissprot | O64836 | 2e-16 | LBD10_ARATH; LOB domain-containing protein 10 | ||||
TrEMBL | A0A3P5YZP8 | 1e-59 | A0A3P5YZP8_BRACM; Uncharacterized protein | ||||
STRING | Bo5g010610.1 | 1e-54 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23660.2 | 2e-16 | LOB domain-containing protein 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|