![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00145155001 | ||||||||
Common Name | GSBRNA2T00145155001, LOC106365696, STO-2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | DBB | ||||||||
Protein Properties | Length: 242aa MW: 26860.3 Da PI: 5.773 | ||||||||
Description | DBB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-B_box | 22.5 | 2.3e-07 | 4 | 43 | 5 | 38 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 C+ +e+ +++ C ++ lC++C +e+H H+ GSBRNA2T00145155001 4 QCDVCEKAPATVICCADEAALCPKCDVEIHAAnklaskHQ 43 7*****************************6566676766 PP | |||||||
2 | zf-B_box | 30.3 | 8.8e-10 | 55 | 86 | 4 | 35 |
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHk 35 ++C+ ++ek + +fC +++ llC+dC +++H GSBRNA2T00145155001 55 PRCDICQEKAAFIFCVEDRALLCRDCDESIHV 86 79*****************************4 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50119 | 9.172 | 1 | 47 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 2.59E-5 | 3 | 45 | No hit | No description |
SMART | SM00336 | 5.9E-7 | 4 | 47 | IPR000315 | B-box-type zinc finger |
SMART | SM00336 | 2.2E-16 | 52 | 99 | IPR000315 | B-box-type zinc finger |
PROSITE profile | PS50119 | 9.67 | 52 | 99 | IPR000315 | B-box-type zinc finger |
Pfam | PF00643 | 1.4E-7 | 55 | 95 | IPR000315 | B-box-type zinc finger |
CDD | cd00021 | 1.85E-8 | 55 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009640 | Biological Process | photomorphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0048573 | Biological Process | photoperiodism, flowering | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0090351 | Biological Process | seedling development | ||||
GO:1902448 | Biological Process | positive regulation of shade avoidance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003712 | Molecular Function | transcription cofactor activity | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MKIQCDVCEK APATVICCAD EAALCPKCDV EIHAANKLAS KHQRLHLNSL ATKFPRCDIC 60 QEKAAFIFCV EDRALLCRDC DESIHVANTR SANHQRFLAT GIKVALSSTS CSSKNQPEPS 120 NNQQKAKEIP AKTLNQQQPS SATPLPWAVD DFFHFSDPEC TDKQKGQLGL GELEWFSDMG 180 FFGDQISQES LPAAEVPELS VSHLGHVHSY RPMKSNVSYK KPRLEFRDDD EEEHFIVPDL 240 G* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.4489 | 0.0 | leaf| seed| vegetative meristem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: High expression in leaves and lower in roots and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of seedling photomorphogenesis and light-regulated inhibition of hypocotyl elongation (PubMed:17605755, PubMed:18540109, PubMed:21685177). BBX24/STO and BBX25/STH function as transcriptional corepressors of HY5 activity, leading to the down-regulation of BBX22 expression. BBX24/STO acts additively with BBX25/STH during de-etiolation and the hypocotyl shade avoidance response (PubMed:23624715). Functions as negative regulator of photomorphogenic UV-B responses by interacting with both COP1 and HY5 (PubMed:22410790). May act as a transcription factor in the salt-stress response (PubMed:12909688). {ECO:0000269|PubMed:12909688, ECO:0000269|PubMed:17605755, ECO:0000269|PubMed:18540109, ECO:0000269|PubMed:21685177, ECO:0000269|PubMed:22410790, ECO:0000269|PubMed:23624715}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00145155001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak before dawn. {ECO:0000269|PubMed:17605755}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN386973 | 0.0 | JN386973.1 Brassica napus salt tolerance protein (STO-2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001302468.1 | 1e-180 | B-box zinc finger protein 24 | ||||
Swissprot | Q96288 | 1e-148 | BBX24_ARATH; B-box zinc finger protein 24 | ||||
TrEMBL | A0A3P6GIL8 | 1e-179 | A0A3P6GIL8_BRAOL; Uncharacterized protein | ||||
TrEMBL | G9HRU7 | 1e-179 | G9HRU7_BRANA; Salt tolerance protein | ||||
STRING | Bo8g005920.1 | 1e-177 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2711 | 27 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06040.1 | 1e-150 | DBB family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106365696 |
Publications ? help Back to Top | |||
---|---|---|---|
|