![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00137289001 | ||||||||
Common Name | GSBRNA2T00137289001, LOC106421331 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 328aa MW: 37556.7 Da PI: 6.6481 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 166.8 | 7.4e-52 | 9 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 +ppGfrFhPt+eelv +yL k+++ k l +vi ++d+yk+ePwd+++ ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg GSBRNA2T00137289001 9 VPPGFRFHPTEEELVGYYLDGKINSIKSAL-DVIVDIDLYKMEPWDIQArckLGYEEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATG 97 69************************9877.99**************953432233677******************************* PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +dk+vls k+++vg++ktLv+ykgrap+g+k+dW+mheyrl GSBRNA2T00137289001 98 RDKAVLS-KNSVVGMRKTLVYYKGRAPNGRKSDWIMHEYRL 137 *******.8889***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.37E-59 | 6 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.452 | 9 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-27 | 10 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 328 aa Download sequence Send to blast |
MDNIKQSCVP PGFRFHPTEE ELVGYYLDGK INSIKSALDV IVDIDLYKME PWDIQARCKL 60 GYEEQNEWYF FSHKDRKYPT GTRTNRATAA GFWKATGRDK AVLSKNSVVG MRKTLVYYKG 120 RAPNGRKSDW IMHEYRLQNS ELAPVQEEGW VVCRAFRKPI PNQRPLGYEP WQNQLYHVDN 180 KNYYSSSATM NTSHHIGASS SSQNLNQMVM SNNHYNANNP SSTIHQYGNI ELPQLDSPSL 240 SPSLGTNKDQ NESLEQEEEK SFNYVDWRTL GSLLEIQATH PQNPNVLVSS LATQSYNPEQ 300 SFPSMHQNYN YEVEANIHHP FGCFPDS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-46 | 9 | 158 | 15 | 168 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Predominantly expressed in immature xylem vessels, only in some cells just beside xylem vessels. Also present in various vascular cells of older part of the roots, near the location of emergence of the lateral roots. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in developing protoxylems in roots and shoots (PubMed:16103214, PubMed:16581911, PubMed:17565617, PubMed:18952777). Detected in root protoxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Present in developing vessels of the secondary xylem in roots undergoing secondary growth (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00137289001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY085424 | 0.0 | AY085424.1 Arabidopsis thaliana clone 151034 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022566399.1 | 0.0 | NAC domain-containing protein 30 | ||||
Swissprot | Q9C8W9 | 0.0 | NAC30_ARATH; NAC domain-containing protein 30 | ||||
TrEMBL | A0A3P6DKS2 | 0.0 | A0A3P6DKS2_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g075130.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6950 | 27 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71930.1 | 0.0 | vascular related NAC-domain protein 7 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106421331 |