PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GSBRNA2T00136855001

Common Name

GSBRNA2T00136855001

Organism

Brassica napus

Taxonomic ID

3708

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9771.9 Da PI: 8.372

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GSBRNA2T00136855001	genome	Genoscope	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	107	1.1e-33	22	79	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kNhAa++Gg+avDGC+Efm+s g egt +al+CaACgCHRnFHRreve+e GSBRNA2T00136855001 22 SNVRYVECQKNHAANIGGYAVDGCREFMAS-GGEGTYDALTCAACGCHRNFHRREVETE 79 689************************9.8899******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-31	1	88	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.8E-30	23	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.0E-27	25	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.696	26	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MKRRQVVIKQ RKSSYTTTSS SSNVRYVECQ KNHAANIGGY AVDGCREFMA SGGEGTYDAL 60 TCAACGCHRN FHRREVETEV VCEYSPPS*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:18713354}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GSBRNA2T00136855001

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013603853.1	3e-60	PREDICTED: mini zinc finger protein 3
Swissprot	Q2Q493	2e-47	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	A0A0D3DWK4	7e-59	A0A0D3DWK4_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6FKQ1	7e-59	A0A3P6FKQ1_BRAOL; Uncharacterized protein
STRING	Bo8g103050.1	1e-59	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	9e-48	mini zinc finger

Publications ? help Back to Top
Chalhoub B, et al. Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome. Science, 2014. 345(6199): p. 950-3 [PMID:25146293]