![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GSBRNA2T00123895001 | ||||||||
Common Name | GSBRNA2T00123895001, LOC106358155 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 184aa MW: 19387.7 Da PI: 10.0765 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56 | 5.2e-18 | 44 | 78 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt TplWR gp g+k+LCnaCG++ rkk++ GSBRNA2T00123895001 44 CVDCGTLRTPLWRGGPAGPKSLCNACGIKSRKKRQ 78 *********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.2E-11 | 38 | 93 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 2.66E-12 | 38 | 79 | No hit | No description |
PROSITE profile | PS50114 | 12.308 | 38 | 92 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.6E-14 | 42 | 78 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 6.72E-12 | 43 | 93 | No hit | No description |
Pfam | PF00320 | 7.2E-16 | 44 | 78 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 44 | 69 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MSEGSVESKS KVDSAGELSD VDNENCSSSG SGGGGSSGET KRTCVDCGTL RTPLWRGGPA 60 GPKSLCNACG IKSRKKRQAA LGIKPEEKKR NRKSNSSSDS DLSFDDHRDA KKKTNKGGDD 120 SSSSKRASNS SSSEGVSKYL DLGFKVPVMK RSAVEKKRLW KKLGEEERAA VLLMALSCGS 180 VFS* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bna.19008 | 1e-119 | seed |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GSBRNA2T00123895001 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189317 | 2e-77 | AC189317.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036B21, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013626140.1 | 1e-126 | PREDICTED: GATA transcription factor 17-like | ||||
Refseq | XP_013653360.1 | 1e-126 | GATA transcription factor 17 | ||||
Swissprot | Q9LIB5 | 6e-83 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | A0A0D3BBP5 | 1e-125 | A0A0D3BBP5_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6AVH6 | 1e-125 | A0A3P6AVH6_BRAOL; Uncharacterized protein | ||||
STRING | Bo3g068560.1 | 1e-126 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12643 | 15 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16870.1 | 3e-72 | GATA transcription factor 17 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 106358155 |
Publications ? help Back to Top | |||
---|---|---|---|
|